GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

neuregulin-1   Click here for help

GtoPdb Ligand ID: 5027

Abbreviated name: NRG-1
Synonyms: breast cancer cell differentiation factor p45 | glial growth factor (GGF) | heregulin | Neu differentiation factor (NDF)
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
SGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRI
NKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHL
VKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Selected 3D Structures
PDB Id: 1hae
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 101, 107 and 145; predicted disulphide bond formation between cysteine resdiues at positions 38 and 93. Disulphide bond formation between cysteine residues at positions 163 and 177, 171 and 191, and 193 and 202