GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

charybdotoxin   Click here for help

GtoPdb Ligand ID: 2328

Synonyms: ChTX | ChTX-Lql
Compound class: Peptide
Comment: From Leiurus quinquestriatus hebraeus (Yellow scorpion). Functions as a blocker of select calcium-activated potassium channels (KCa) [2].
Click here for help
Peptide Sequence Click here for help
QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
pGlu-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser
Post-translational Modification
C-terminal glutamine is pyrrolidone carboxylic acid; disulphide bond formation between cysteine residues at positions 7 and 28, 13 and 33, and 17 and 35.