GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

OMN6   Click here for help

GtoPdb Ligand ID: 14120

Compound class: Peptide
Comment: OMN6 is a cyclic antimicrobial peptide based on the sequence of cecropin A, with activity against drug-resistant Gram-negative bacteria [1].
Peptide Sequence Click here for help
MCKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKC
Chemical Modification
Disulphide bond formation between cysteine residues at positions 2 and 40.